how to convert a file to fasta format in mega 7

So, it looks like I have a path to doing what I wanted in the first place - getting from.

clustalw2 -tree -infile=droso.alnĪnd obtained a file droso.ph which looks like a Newick format file to me (some lines): ( Then on Christoph's page, there is a section: This produces a droso.aln file which looks like this (only a few lines shown): D_paulistorum ETRVAEKLLEHPTQTTLACAQNFVKAIELNKNGAIWKLDLGTLEPIEWTKĭ_insularis ETRVAEKLLEHPTQTTLACAQNFVKAIELNKNGAIWKLDLGTLEPIEWTKĭ_equinoxialis ETRVAEKLLEHPTQTTLACAQNFVKAIELNKNGAIWKLDLGTLEPIEWTKĭ_willistoni ETRVAEKLLEHPTQTTLACAQNFVKAIELNKNGAIWKLDLGTLEPIEWTK clustalw2 -align -type=protein -infile=droso.fasta Go to the file and use edit replace and replace all the spaces into underline. So, I had my clustalw2 executable and my 25 Drosophila alcohol dehydrogenase protein sequences and I ran the following commands (from Christoph's page). I tried compiling Clustalx (GUI - problem with qmake) which didn't work, but Clustalw (compiled to exe clustalw2) - the command line tool - worked a treat.

The MEGA file converter looks for a line that begin with a greater-than sign (‘ >’), replaces it with a pound sign (‘ #’), takes the word following the pound sign as the sequence name, deletes the rest of the line, and takes the following lines (up to the next line beginning with a ‘>’) as the sequence data.Answer led me to and some searching led me to this page ( Christoph's). TTGCTGCTTAGAGTCAAAGCATGTACTTAGAGTTGGTATGATTTATCTTTTTGGTCTTCT GTAGGACTTCATTCTAGTCATTATAGCTGCTGGCAGTATAACTGGCCAGCCTTTAATACA GGTATGATTTATCTTTTTGGTCTTCTATAGCCTCCTTCCCCATCCCCATCAGTCTTAATCĪGTCTTGTTACGTTATGACTAATCTTTGGGGATTGTGCAGAATGTTATTTTAGATAAGCAĬATAAGCTCCTTTTAACTTGTTAAAGTCTTGCTTGAATTAAAGACTTGTTTAAACACAAAĪTTTAGACTTTTACTCAACAAAAGTGATTGATTGATTGATTGATTGATTGATGGTTTACA Output format: fasta This refers to the input FASTA file format introduced for Bill Pearsons FASTA tool, where each record starts with a > line. This is an example of a sample input file:ĪTACATCATAACACTACTTCCTACCCATAAGCTCCTTTTAACTTGTTAAAGTCTTGCTTGĪATTAAAGACTTGTTTAAACACAAAAATTTAGAGTTTTACTCAACAAAAGTGATTGATTGĪTTGATTGATTGATTGATGGTTTACAGTAGGACTTCATTCTAGTCATTATAGCTGCTGGCĪGTATAACTGGCCAGCCTTTAATACATTGCTGCTTAGAGTCAAAGCATGTACTTAGAGTT Online converter from Tab to Fasta online without need to install any software, or learn how to convert between tab to fasta formats using BioPython. The FASTA file format is very simple and is quite similar to the MEGA file format. Converting FASTA format Converting FASTA format

How to convert a file to fasta format in mega 7